DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and prrx1a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_999899.1 Gene:prrx1a / 406431 ZFINID:ZDB-GENE-020905-5 Length:245 Species:Danio rerio


Alignment Length:235 Identity:79/235 - (33%)
Similarity:119/235 - (50%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 SLAHSL----SPPNDIES--LASIGH---QRNCPVA-TEDIHLKKELDGHQSDETGSGEGEN--- 447
            |.||.:    :.||.:|:  .|:..|   ::|..|: ..|:...:|:.|.|::|:....|.:   
Zfish     4 SYAHVMDRQATLPNRLETAITANQDHLQAKKNFSVSHLLDLEEAREMVGAQAEESAGEAGRSMLE 68

  Fly   448 SNGGASNIGNTEDDQARLIL----KRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKI 508
            |.|..|....|:.:..:|..    |||.:||||:|.:.|:.:||:.||||||||.|.||.||.::
Zfish    69 SPGLTSGSDTTQQENEQLNAEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPDAFVREDLARRV 133

  Fly   509 GLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDS--PNSLSACSSLL 571
            .|.|||:||||.|||||:|     ||:|....|..||...|.:....::...  |......:..|
Zfish   134 NLTEARVQVWFQNRRAKFR-----RNERAMLASKNASLLKSFSGEVTAVEQPIVPRPAPRPNDYL 193

  Fly   572 S-GSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSES 610
            | ||:  ||.|.:      :|.|.:....|...|::.:.|
Zfish   194 SWGSS--PSYSAM------ATYSPSCANNTTAQGMNMANS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
prrx1aNP_999899.1 Homeobox 101..152 CDD:278475 31/50 (62%)
OAR 220..237 CDD:281777 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.