Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_991238.1 | Gene: | pitx3 / 402974 | ZFINID: | ZDB-GENE-041229-4 | Length: | 293 | Species: | Danio rerio |
Alignment Length: | 269 | Identity: | 75/269 - (27%) |
---|---|---|---|
Similarity: | 110/269 - (40%) | Gaps: | 73/269 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 402 SPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLI 466
Fly 467 LKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531
Fly 532 LRNQRRTPNSTGA-------------SATSSSTSATASLTDSP---------------------- 561
Fly 562 -------NSLSACSSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTL-GAGIDSSESP---TPIP 615
Fly 616 HI-RPSCTS 623 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 27/51 (53%) | ||
pitx3 | NP_991238.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..69 | 18/77 (23%) | |
Cnd2 | 18..>79 | CDD:303063 | 20/82 (24%) | ||
Homeobox | 64..116 | CDD:278475 | 27/51 (53%) | ||
OAR | 251..268 | CDD:281777 | 2/5 (40%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 255..268 | 1/1 (100%) | |||
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O35160 | 260..264 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |