DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and pitx3

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_991238.1 Gene:pitx3 / 402974 ZFINID:ZDB-GENE-041229-4 Length:293 Species:Danio rerio


Alignment Length:269 Identity:75/269 - (27%)
Similarity:110/269 - (40%) Gaps:73/269 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 SPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLI 466
            ||...:....:..|...|             .|..:.:|     |.|:...::..|.||..    
Zfish    13 SPALSLSDSGTPQHDPGC-------------KGQDNSDT-----EKSHQNHTDESNPEDGS---- 55

  Fly   467 LKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531
            ||:|.:|.||.||:.|:..||..|:|..|||:..||.:|....|.|||::|||.|||||||:.|:
Zfish    56 LKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRER 120

  Fly   532 LRNQRRTPNSTGA-------------SATSSSTSATASLTDSP---------------------- 561
            .:......|..||             |..|.:..||.||..||                      
Zfish   121 NQQAELCKNGFGAQFNGLMQPYDDMYSGYSYNNWATKSLASSPLSAKSFPFFNSMNVSPLSSQPM 185

  Fly   562 -------NSLSACSSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTL-GAGIDSSESP---TPIP 615
                   .|::..||::..:..|...|.:|.|.:    ..|:|:||| .|.:.::..|   |..|
Zfish   186 FSPPSSIPSMNMASSMVPSAVAGVPGSGLNNLGN----LNNLNSPTLNSAAVSAAACPYATTAGP 246

  Fly   616 HI-RPSCTS 623
            :: |.:|.|
Zfish   247 YMYRDTCNS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 27/51 (53%)
pitx3NP_991238.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 18/77 (23%)
Cnd2 18..>79 CDD:303063 20/82 (24%)
Homeobox 64..116 CDD:278475 27/51 (53%)
OAR 251..268 CDD:281777 2/5 (40%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 255..268 1/1 (100%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:O35160 260..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.