DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and cdx4

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_989417.1 Gene:cdx4 / 395056 XenbaseID:XB-GENE-482787 Length:260 Species:Xenopus tropicalis


Alignment Length:281 Identity:77/281 - (27%)
Similarity:111/281 - (39%) Gaps:68/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 LGTRSSHPQLVHGNHQALQQHQQQSW---------PPRHYSGS----WYPTSLSEIPISSAPNIA 386
            |..||:     ..||.|......|.:         ||....|.    |.|.       ..:|. .
 Frog    19 LSVRSA-----SNNHSAQNYASNQPYFNYVTYHHVPPMDEQGQPCGVWGPQ-------YGSPR-E 70

  Fly   387 SVTAYASGPS---LAHS--LSPPNDIESLASIGHQRNCPVATEDIHLKKELD-GHQSDETGSGEG 445
            ...:|.:|||   :|.|  || ||.. :..|.|:....|..|..:|   .:| .|.:..:.|...
 Frog    71 QWNSYGAGPSNTNMAQSSDLS-PNQF-AYNSSGYSSPHPSGTGILH---SVDLSHTAANSPSDLS 130

  Fly   446 ENS------NGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERL 504
            :||      ...:::.|.|          |..::.|..:|:.|...|||||..:.|..:..:..|
 Frog   131 QNSYEWMGKTVQSTSTGKT----------RTKEKYRVVYTDHQRLELEKEFHYSRYITIRRKTEL 185

  Fly   505 AGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSS 569
            |..:.|.|.::::||.|||||   |.||..::........|..|.|:||      |||.|  |.|
 Frog   186 AASLRLSERQVKIWFQNRRAK---ERKLFKKKMNQFDGICSVQSDSSSA------SPNPL--CDS 239

  Fly   570 L----LSGSAGGPSVSTINGL 586
            :    :|||...|....:|||
 Frog   240 VVHTDMSGSLYQPPPIALNGL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 20/51 (39%)
cdx4NP_989417.1 Caudal_act 16..139 CDD:282574 33/137 (24%)
Homeobox 156..208 CDD:278475 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.