DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and PHDP

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:137 Identity:52/137 - (37%)
Similarity:74/137 - (54%) Gaps:30/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 NIG--NTE-------DDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIG 509
            |||  ||:       ||...|..|.|.:|.||:||::|::.|||.|..|||||::.||.:|.|:.
  Fly    86 NIGSYNTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLH 150

  Fly   510 LPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGS 574
            |.|||:||||.|||||:|::|:                    .|...:.|..:.|....:.::||
  Fly   151 LTEARVQVWFQNRRAKFRKQER--------------------HAIYIMKDKSSKLDGRKNPVAGS 195

  Fly   575 AG-GPSV 580
            .. |||:
  Fly   196 KYLGPSL 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 31/51 (61%)
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 31/51 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.