DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Gsx2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:342 Identity:79/342 - (23%)
Similarity:126/342 - (36%) Gaps:95/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 TGSGSSSTSAGNSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTATPLNSSESGGASNSGEGS 296
            :|.|..|..:|......:.|:...:.|...:|:.|..:.:.         .::.:||....|.|:
  Rat    46 SGPGCPSRKSGAFCVCPLCVTSHLHSSRPPAGAGGGATGTA---------GAAVAGGGVAGGTGA 101

  Fly   297 EQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWP 361
                    |.||.:|.:.|||   .|:..|           |.||   .|.:|.|.|.|.....|
  Rat   102 --------LPLLKSQFSPGPG---DAQFCP-----------RVSH---AHHHHHAPQHHHHHHQP 141

  Fly   362 PRHYSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGH-QRNCPV-ATE 424
            .:                   |..|:..|.|:..:.|          :.|::|| |.:.|| |..
  Rat   142 QQ-------------------PGSAAAAAAAAAAAAA----------AAAALGHPQHHAPVCAAT 177

  Fly   425 DIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKE 489
            ..::......|.....||...:..||                     :|.||:||:.|:..||:|
  Rat   178 TYNVSDPRRFHCLTMGGSDTSQVPNG---------------------KRMRTAFTSTQLLELERE 221

  Fly   490 FERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK--LRNQRRTPNSTGASATSSSTS 552
            |....|.....|..:|..:.|.|.::::||.|||.|.::|.|  .||..       ||.....:.
  Rat   222 FSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGASRNNH-------ASCKCVGSQ 279

  Fly   553 ATASLTDSPNSLSACSS 569
            |..:.::..:|||..|:
  Rat   280 AHYARSEDEDSLSPASA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 20/51 (39%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.