DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Gsc2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001102316.1 Gene:Gsc2 / 363831 RGDID:1305333 Length:214 Species:Rattus norvegicus


Alignment Length:237 Identity:66/237 - (27%)
Similarity:97/237 - (40%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 LRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSW 369
            ||||.          .|.......|.:.:|.......|..:.....:|.:.:..:.||:...|. 
  Rat     4 LRLLR----------RPPAGMATAGSAASHRDPGRPCPFSIEHILSSLPERRPVARPPQPVGGR- 57

  Fly   370 YPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDG 434
            .|....| |.:.||...........|..|    |....|:.:..|.:...|     :.|..|   
  Rat    58 NPAEPDE-PEAPAPAAPCACCCCCNPRAA----PRGTPETASGPGLRLGWP-----LRLAPE--- 109

  Fly   435 HQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVF 499
            ..|..|....|..:..|.|..|.          :|:.:|:||.|:.:|:.:||..|.:..||||.
  Rat   110 SPSPLTAPSTGSPALTGTSGPGP----------QRRTRRHRTIFSEEQLQALEALFVQNQYPDVG 164

  Fly   500 ARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNS 541
            .|||||.:|.|.|.|::|||.|||||||.::::.:.|..|.|
  Rat   165 TRERLAVRIRLREERVEVWFKNRRAKWRHQKRVSSSRLAPGS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 28/51 (55%)
Gsc2NP_001102316.1 Homeobox 139..193 CDD:395001 29/53 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.