DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and otx5

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_851848.2 Gene:otx5 / 353179 ZFINID:ZDB-GENE-030508-1 Length:289 Species:Danio rerio


Alignment Length:268 Identity:83/268 - (30%)
Similarity:111/268 - (41%) Gaps:84/268 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLR 533
            ||.:|.||:||..|:|.||..|.:|.|||:|.||.:|.||.|||:|:||||.|||||.|::::.:
Zfish    36 RKQRRERTTFTRAQLDVLEALFSKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQ 100

  Fly   534 NQRRT-------------------------------PNSTGASATSSSTSATASLTDSPNSLSAC 567
            ...:|                               |...|.:.|.||:|||.|:. ||.|:|..
Zfish   101 TSGQTKPRPPKKKSSPARDSSASEPSASTSGPYSPPPPPPGTAITPSSSSATVSIW-SPASISPL 164

  Fly   568 SSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESP-TPIPHIRPSCTSDNDNGRQS 631
            ...||    .||.:.:...|.|.|.|   .||..|....:|.|. |.:                 
Zfish   165 PDPLS----APSTACLQRSSYPMTYS---QAPAYGQSYAASSSYFTGL----------------- 205

  Fly   632 EDCRRVCSPCPLGVGGHQNTHHIQSNGHAQGHALVPAISPRLNFNSGSFG---AMYSNMHHTALS 693
             ||....||.                 |.|..|...|:||.    ||:..   |..|:..:||.|
Zfish   206 -DCSSYLSPM-----------------HPQLSASGGALSPM----SGALSQSPASLSSQGYTAAS 248

  Fly   694 MSDSYGAV 701
            :  .:|.|
Zfish   249 L--GFGTV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
otx5NP_851848.2 Homeobox 42..94 CDD:278475 32/51 (63%)
TF_Otx 157..231 CDD:281521 29/119 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.