Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_851848.2 | Gene: | otx5 / 353179 | ZFINID: | ZDB-GENE-030508-1 | Length: | 289 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 83/268 - (30%) |
---|---|---|---|
Similarity: | 111/268 - (41%) | Gaps: | 84/268 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 469 RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLR 533
Fly 534 NQRRT-------------------------------PNSTGASATSSSTSATASLTDSPNSLSAC 567
Fly 568 SSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESP-TPIPHIRPSCTSDNDNGRQS 631
Fly 632 EDCRRVCSPCPLGVGGHQNTHHIQSNGHAQGHALVPAISPRLNFNSGSFG---AMYSNMHHTALS 693
Fly 694 MSDSYGAV 701 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 32/51 (63%) | ||
otx5 | NP_851848.2 | Homeobox | 42..94 | CDD:278475 | 32/51 (63%) |
TF_Otx | 157..231 | CDD:281521 | 29/119 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |