DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and AgaP_AGAP009630

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_553424.2 Gene:AgaP_AGAP009630 / 3292016 VectorBaseID:AGAP009630 Length:410 Species:Anopheles gambiae


Alignment Length:260 Identity:52/260 - (20%)
Similarity:90/260 - (34%) Gaps:66/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 PARAAP--LVG--------------QSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPP------- 362
            |.|..|  :||              ||....|.....|:.|....:..:..|:.:.||       
Mosquito     7 PGRTTPETMVGGIRKWEQLSRTAGKQSLAPFGDGYETPRQVKSRKEDSESDQEPTEPPEEDDQYT 71

  Fly   363 -RHYSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDI 426
             :|||.|.:.|...|.....|.......:..:.|.:..|..||...|..:.:.|..         
Mosquito    72 EQHYSESEFHTEQEEDDDEQADRNEHGWSEHAHPPIQVSQYPPKRFEQGSHLLHID--------- 127

  Fly   427 HLKKELDGHQSDETGSGEGENSNG----GASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLE 487
            .:..||...:...:|...|....|    ||:...:....|       :.|::..||:.:::    
Mosquito   128 FITDELGRFELPSSGQSRGRRPMGMVGSGATGRKSASGQQ-------QSQQHNISFSRERV---- 181

  Fly   488 KEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTS 552
            :|.|||:       :.|..:|......:|...|::..|           ||.::..:.|||::|:
Mosquito   182 REIERTN-------QILLRRIITTRPTLQTQTSSKPVK-----------RTSSTNASPATSAATN 228

  Fly   553  552
            Mosquito   229  228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 11/51 (22%)
AgaP_AGAP009630XP_553424.2 KIAA1430 <173..246 CDD:290590 17/78 (22%)
PDZ 250..319 CDD:238080
PDZ 335..399 CDD:238080
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.