DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and sdcbp2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_997856.1 Gene:sdcbp2 / 325004 ZFINID:ZDB-GENE-030131-3727 Length:299 Species:Danio rerio


Alignment Length:235 Identity:45/235 - (19%)
Similarity:78/235 - (33%) Gaps:85/235 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PSLEDMAHKDNVIAMRNLPCLGTAGGSGLGGIAGKPSPTMEAVEASTASHPH--STSSYFATTYY 90
            |||||: ..|.||..::.....|:....:...|.:|.|..:.:.:||. :|:  ....|...:  
Zfish     5 PSLEDL-KVDKVIRAQSQFANATSSTPAITQGAYQPQPATQGMPSSTL-YPNLEELGDYMGLS-- 65

  Fly    91 HLTDDECHSGV------------NQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDIS------- 136
             |..||....:            :.:||:.   ||         |..|..|.|..:|.       
Zfish    66 -LNSDEVQRNLALVPVATQVAVPSSVGGMV---RP---------VTGADMGIRRAEIRPGLREVI 117

  Fly   137 -----------RILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATAEVVSKISQYKRECPSI 190
                       |:..:.||...:::    :..|  |.|:.|.:                      
Zfish   118 LCKDQEGKVGLRLRDIDNGVFVQLV----QANS--PAALAGLR---------------------- 154

  Fly   191 FAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQ 230
                ..|::||.|   ..|:...:| ::..:.|.|..||:
Zfish   155 ----FGDQVLQIN---GQNVAGWNS-DKAHKALKAAAEQR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 22/152 (14%)
Homeobox 475..527 CDD:278475
sdcbp2NP_997856.1 PDZ_signaling 113..>173 CDD:238492 13/95 (14%)
PDZ_signaling 198..270 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.