DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HOXD9

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_055028.3 Gene:HOXD9 / 3235 HGNCID:5140 Length:352 Species:Homo sapiens


Alignment Length:279 Identity:61/279 - (21%)
Similarity:85/279 - (30%) Gaps:95/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 GGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQA 351
            |||...|.|.                ..|||.          |.||...|.       .:|.|..
Human   128 GGAGGGGGGG----------------GGGPGR----------GPSPGPSGP-------ANGRHYG 159

  Fly   352 LQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDI----ESLAS 412
            ::                     .|...:.||..|:.|..:|..||:.| |...:.    ||..|
Human   160 IK---------------------PETRAAPAPATAASTTSSSSTSLSSS-SKRTECSVARESQGS 202

  Fly   413 IGHQRNCPVATEDIHLKKELDGHQSDETGSGEG---ENSNGGASNIGNTED-------------- 460
            .|.:.:|.      ...:|.....:..||.|.|   ....||:|......|              
Human   203 SGPEFSCN------SFLQEKAAAATGGTGPGAGIGAATGTGGSSEPSACSDHPIPGCSLKEEEKQ 261

  Fly   461 -------------DQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPE 512
                         ..|..|..|..::.|..:|..|...|||||....|.....|..:|..:.|.|
Human   262 HSQPQQQQLDPNNPAANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTE 326

  Fly   513 ARIQVWFSNRRAKWRREEK 531
            .::::||.|||.|.::..|
Human   327 RQVKIWFQNRRMKMKKMSK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/51 (37%)
HOXD9NP_055028.3 Hox9_act 11..>164 CDD:282473 14/89 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..208 28/134 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..276 5/46 (11%)
HOX 285..337 CDD:197696 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.