Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076922.1 | Gene: | HOXB9 / 3219 | HGNCID: | 5120 | Length: | 250 | Species: | Homo sapiens |
Alignment Length: | 260 | Identity: | 60/260 - (23%) |
---|---|---|---|
Similarity: | 92/260 - (35%) | Gaps: | 83/260 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 336 GTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLS-------EIPISS----AP----NI 385
Fly 386 ASVTAYASG--PSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEG--- 445
Fly 446 -----------------------ENSNGGASNIGN-------------TED----DQ----ARLI 466
Fly 467 LKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531
Fly 532 531 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 19/51 (37%) | ||
HOXB9 | NP_076922.1 | Hox9_act | 1..172 | CDD:282473 | 36/185 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 21..47 | 4/25 (16%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 149..182 | 6/32 (19%) | |||
Homeobox | 188..241 | CDD:278475 | 19/52 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |