DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and HOXB8

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_076921.1 Gene:HOXB8 / 3218 HGNCID:5119 Length:243 Species:Homo sapiens


Alignment Length:180 Identity:49/180 - (27%)
Similarity:77/180 - (42%) Gaps:39/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 GPSLAHSLSPPNDIE-------SLASIGHQRN-CPVATE---------DIHLKKELDGHQSDE-- 439
            |||...|...|:.|:       ||::..:|:| |.||..         |...::.|.|.|..:  
Human    41 GPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDLV 105

  Fly   440 --------TGSGEGENSNGGASNIGNTE-----DDQARLILKRKLQRNRTSFTNDQIDSLEKEFE 491
                    ..||.||.:.|...:...|:     ..||    ....:|.|.:::..|...|||||.
Human   106 QYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQA----AAGRRRGRQTYSRYQTLELEKEFL 166

  Fly   492 RTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNS 541
            ...|.....|..::..:||.|.::::||.|||.||::|   .|:.:.|:|
Human   167 FNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKE---NNKDKFPSS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
HOXB8NP_076921.1 Antp-type hexapeptide 134..139 0/4 (0%)
Homeobox 150..203 CDD:395001 19/52 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..243 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.