DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Hoxc5

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 / 315341 RGDID:1307584 Length:222 Species:Rattus norvegicus


Alignment Length:262 Identity:64/262 - (24%)
Similarity:92/262 - (35%) Gaps:85/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 NSGEGSEQEA---IYEKLRL---------LNTQH----AAGPGPLEPARAAPLVGQSPNHLGTRS 339
            |.|..||.:|   .|..|.|         .|:.|    ||.| ...|.|.|.....:|.|     
  Rat    26 NYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANP-RAHPDRPACSAAAAPGH----- 84

  Fly   340 SHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYASGPS-LAHSLSP 403
                       ||.:.:.....|..||......:|.|...||. .|....|....|: |:...:|
  Rat    85 -----------ALGRDEAAPLNPGMYSQKAARPALEERAKSSG-EIKEEQAQTGQPAGLSQPPAP 137

  Fly   404 PNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILK 468
            |            :..|..|: :|:..|.||                                  
  Rat   138 P------------QIYPWMTK-LHMSHETDG---------------------------------- 155

  Fly   469 RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLR 533
               :|:|||:|..|...|||||....|.....|..:|..:.|.|.:|::||.|||.||:::.|::
  Rat   156 ---KRSRTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMK 217

  Fly   534 NQ 535
            ::
  Rat   218 SK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 22/106 (21%)
Homeobox 158..212 CDD:395001 23/53 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.