DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and msx1b

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571335.1 Gene:msx1b / 30511 ZFINID:ZDB-GENE-980526-26 Length:257 Species:Danio rerio


Alignment Length:260 Identity:56/260 - (21%)
Similarity:96/260 - (36%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 QQHQQQSWPPRHYSG--------SWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIES 409
            :...::|..||..:.        ::.|.|:..:...|     |....|..|:|.|.         
Zfish    17 ESDSEESQKPRDMTADTGHKAKKTYLPFSVESLMAKS-----SCQQVACSPALQHQ--------- 67

  Fly   410 LASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDD------------- 461
              .:||.::. |.|..:...|     .|.:|.|...::.|..:..:.:.|..             
Zfish    68 --RMGHGQDL-VRTYFVEKAK-----VSVDTLSSVSDSLNDDSEELSDKEQSTWSNSSSFTSPPR 124

  Fly   462 ----QARLILKRKLQRN-RTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSN 521
                ....:.|.|..|. ||.|:..|:.|||::|.:..|..:..|...:..:.|.|.::::||.|
Zfish   125 HPSPTPCTLRKHKTNRKPRTPFSTSQLLSLERKFRQKQYLSIAERAEFSNSLNLTETQVKIWFQN 189

  Fly   522 RRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGL 586
            ||||.:|.::...::       ....|....|..:|   |..|.:.|||....|..|....:.||
Zfish   190 RRAKAKRLQEAELEK-------FKCASKPLLAPFAL---PFPLGSPSSLYGPPASFPRPVPMPGL 244

  Fly   587  586
            Zfish   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/51 (37%)
msx1bNP_571335.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 8/54 (15%)
Homeobox 142..195 CDD:278475 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.