DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and otx2b

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571326.1 Gene:otx2b / 30501 ZFINID:ZDB-GENE-980526-406 Length:289 Species:Danio rerio


Alignment Length:335 Identity:88/335 - (26%)
Similarity:130/335 - (38%) Gaps:123/335 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREE--- 530
            ||.:|.||:||..|:|.||..|.:|.|||:|.||.:|.||.|||:|:||||.|||||.|:::   
Zfish    36 RKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQ 100

  Fly   531 ------KLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTIN---GL 586
                  |:|..::  .|:.|...||.:.|:...| .|:|.|.           |::||..   .:
Zfish   101 QNGGQNKVRPAKK--KSSPAREASSESGASGQFT-PPSSTSV-----------PAISTTTAPVSI 151

  Fly   587 SSPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLGVGGHQNT 651
            .||:::|                     |...|..||.:        |.:...|..         
Zfish   152 WSPASIS---------------------PLSDPLSTSSS--------CMQRSYPMT--------- 178

  Fly   652 HHIQSNGHAQGHALVPAISPRLNFNSGS---FGAMYSNMHHTALSMSDSYGAVTPIPSFNHSAVG 713
             :.|::|::||:|             ||   ||.|            |....:||:   :|...|
Zfish   179 -YTQASGYSQGYA-------------GSTSYFGGM------------DCGSYLTPM---HHQLTG 214

  Fly   714 PLAPPSPIPQQGDLTPSSLYPCHMTLRPPPMAPAHHHIVPGDGGRPAGVGL------------GS 766
            |.:..||:       .|:....|:...|..:        |..|...:|:|.            .|
Zfish   215 PGSTLSPM-------SSNAVTSHLNQSPASL--------PTQGYGASGLGFNSTADCLDYKDQAS 264

  Fly   767 GQSANLGASC 776
            ....|..|.|
Zfish   265 SWKLNFNADC 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
otx2bNP_571326.1 Homeobox 42..94 CDD:395001 32/51 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..142 13/62 (21%)
TF_Otx 155..234 CDD:397546 27/152 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.