DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and en2a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571119.2 Gene:en2a / 30243 ZFINID:ZDB-GENE-980526-167 Length:265 Species:Danio rerio


Alignment Length:210 Identity:56/210 - (26%)
Similarity:81/210 - (38%) Gaps:60/210 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 NHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIES--- 409
            ||.|.:.| ..:.|.....||..|.           ..||.|..:||...|       :|||   
Zfish    67 NHGARENH-NPTGPSTGQVGSTVPA-----------EEASTTHTSSGGKEA-------EIESEEP 112

  Fly   410 LASIGHQRNCPVATEDIHLKKELDGHQSD---ETGSG-----------------EGENSNGGASN 454
            |...|.       ..|..|..|.|..||:   :||.|                 .|..|......
Zfish   113 LKPRGE-------NVDQCLGSESDSSQSNSNGQTGQGMLWPAWVYCTRYSDRPSSGPRSRKPKKK 170

  Fly   455 IGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWF 519
            ..:.||           :|.||:||.:|:..|:.||:...|.....|:.||.::||.|::|::||
Zfish   171 AASKED-----------KRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELGLNESQIKIWF 224

  Fly   520 SNRRAKWRREEKLRN 534
            .|:|||.::...::|
Zfish   225 QNKRAKIKKASGVKN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
en2aNP_571119.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..142 27/100 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..180 5/35 (14%)
Homeobox 179..232 CDD:278475 22/52 (42%)
Engrail_1_C_sig 234..263 CDD:287495 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.