Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571092.1 | Gene: | gsc / 30212 | ZFINID: | ZDB-GENE-980528-2060 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 57/204 - (27%) |
---|---|---|---|
Similarity: | 94/204 - (46%) | Gaps: | 48/204 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 382 APNIASVTA------YASGPSLAHSLSPPNDIESLASIGHQRNCP-VATEDIHLKKELDGHQSDE 439
Fly 440 TGSGEGENSNGGA------------SNIGNTEDDQARLILK---RKLQRNRTSFTNDQIDSLEKE 489
Fly 490 FERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSAT 554
Fly 555 ASLTDSPNS 563 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 28/51 (55%) | ||
gsc | NP_571092.1 | Homeobox | 149..202 | CDD:278475 | 28/52 (54%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 199..240 | 10/40 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |