DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and gsc

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571092.1 Gene:gsc / 30212 ZFINID:ZDB-GENE-980528-2060 Length:240 Species:Danio rerio


Alignment Length:204 Identity:57/204 - (27%)
Similarity:94/204 - (46%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 APNIASVTA------YASGPSLAHSLSPPNDIESLASIGHQRNCP-VATEDIHLKKELDGHQSDE 439
            |||:.||..      |..|.......:.|....::.::|.|: || :.|                
Zfish    57 APNLQSVNGRIGYNNYYYGQLHVQGPTGPACCGAIPTLGSQQ-CPCIPT---------------- 104

  Fly   440 TGSGEGENSNGGA------------SNIGNTEDDQARLILK---RKLQRNRTSFTNDQIDSLEKE 489
                 |.:|.|..            .|:|.....:.:|:.:   |:.:|:||.||::|:::||..
Zfish   105 -----GYDSAGSVLISPVPHQMMSYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENL 164

  Fly   490 FERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSAT 554
            |:.|.||||..||:||.|:.|.|.:::|||.||||||||:::..::    .|..:...:.||..|
Zfish   165 FQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSE----ESENSQKWNKSTKTT 225

  Fly   555 ASLTDSPNS 563
            :...:...|
Zfish   226 SEKIEEGKS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 28/51 (55%)
gscNP_571092.1 Homeobox 149..202 CDD:278475 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 199..240 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.