DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and dharma

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_571054.1 Gene:dharma / 30170 ZFINID:ZDB-GENE-990415-22 Length:192 Species:Danio rerio


Alignment Length:106 Identity:35/106 - (33%)
Similarity:49/106 - (46%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 TEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNR 522
            |.::....|.:|...|.||.||::|.:.||:.|..|.||.|..|..||...||.|..::|||.||
Zfish   102 TAENHYHTIAQRPRGRIRTVFTDNQTEQLERLFAVTDYPTVETRAELAQNTGLSEETVRVWFKNR 166

  Fly   523 RAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNS 563
            ||:.:|:                .|.:...|..:|.|...|
Zfish   167 RARRKRQ----------------TTCADKHANRALEDHQES 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 26/54 (48%)
dharmaNP_571054.1 Homeodomain 117..172 CDD:459649 26/54 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.