DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and GSC2

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_005306.1 Gene:GSC2 / 2928 HGNCID:4613 Length:205 Species:Homo sapiens


Alignment Length:64 Identity:33/64 - (51%)
Similarity:48/64 - (75%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 KRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531
            :|:.:|:||.|:.:|:.:||..|.:..||||..||||||:|.|.|.|::|||.|||||||.:::
Human   123 QRRTRRHRTIFSEEQLQALEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAKWRHQKR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeodomain 473..528 CDD:459649 31/54 (57%)
GSC2NP_005306.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..58
Homeodomain 127..183 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..205 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.