DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Mixl1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001099449.1 Gene:Mixl1 / 289311 RGDID:1310011 Length:231 Species:Rattus norvegicus


Alignment Length:148 Identity:53/148 - (35%)
Similarity:74/148 - (50%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 QRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRRE-----EK 531
            :|.||||:::|:..||..|.:|.|||:..|||||....|||:||||||.|||||.||:     :.
  Rat    87 RRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQP 151

  Fly   532 LRNQR-----RTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPST 591
            |.::|     |....|.|..........|.:....:|        |.:.||...|...|..:.|:
  Rat   152 LSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDS--------SMAGGGVCTSGSQGFETYSS 208

  Fly   592 LSTNVNAPTLGAGIDSSE 609
            ||.::     |:.:||.|
  Rat   209 LSEDI-----GSKLDSWE 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 31/51 (61%)
Mixl1NP_001099449.1 PRK14971 <2..139 CDD:237874 29/51 (57%)
Homeobox 89..143 CDD:395001 31/53 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.