Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001093967.1 | Gene: | Hoxb9 / 287647 | RGDID: | 1306158 | Length: | 250 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 58/260 - (22%) |
---|---|---|---|
Similarity: | 90/260 - (34%) | Gaps: | 83/260 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 336 GTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWY-----PTSLSEIPISS------AP----NI 385
Fly 386 ASVTAYASG--PSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEG--- 445
Fly 446 -----------------------ENSNGGASNIGN-------------TED----DQ----ARLI 466
Fly 467 LKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531
Fly 532 531 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 19/51 (37%) | ||
Hoxb9 | NP_001093967.1 | Hox9_act | 1..172 | CDD:398350 | 34/185 (18%) |
Homeobox | 188..242 | CDD:395001 | 19/53 (36%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |