DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and ind

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:389 Identity:86/389 - (22%)
Similarity:135/389 - (34%) Gaps:122/389 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 NLAAQKEQQSTGSGSSSTSAGNSISAKVSVSIGGNVSNVASGSRGTLSSSTDLMQTATPLNS-SE 285
            ||:.:||:..:..||.:.:|                   |..:...|.|...|...|:.:.| ..
  Fly    16 NLSQKKEKLGSPGGSPTAAA-------------------AVAAAAMLPSIPMLPYPASYVGSYLF 61

  Fly   286 SGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAA----PLVGQSPNHLGTRSSHPQLVH 346
            |.|.....:..:|:          .||||.......|.||    |.|..||..|    .||    
  Fly    62 SLGIQQQQQQQQQQ----------QQHAAAAAAAAAAAAALQQHPHVSSSPGSL----YHP---- 108

  Fly   347 GNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPN--------------------IASVTAY 391
              :..|...:::|....:|.|. ||:.    |:|:.||                    :....::
  Fly   109 --YAQLFASKRKSSGFSNYEGC-YPSP----PLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSF 166

  Fly   392 ASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGEN-SNGGASNI 455
            .:.||.:.|          ||:.:..|.     |....|......|....|...:| |:||...|
  Fly   167 CTSPSASSS----------ASLDYTNNF-----DEPQGKRFKHESSCSPNSSPLKNHSSGGPVEI 216

  Fly   456 GNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFS 520
            ....:|.|     ...:|.||:||:.|:..||:||....|.....|..:|.::.|.|.::::||.
  Fly   217 TPLINDYA-----DSSKRIRTAFTSTQLLELEREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQ 276

  Fly   521 NRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTIN 584
            |||.|.::                   ..|.|.|.:|:.:.|             |.|..|.::
  Fly   277 NRRVKQKK-------------------GGSESPTFNLSTNSN-------------GSPQASPVS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 20/51 (39%)
indNP_996087.2 Homeobox 231..283 CDD:278475 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.