DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and VENTX

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:252 Identity:66/252 - (26%)
Similarity:102/252 - (40%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 SLSPPNDIESLASIG-----HQRNCPVATEDIHLKKELDGHQSDETGSGEGENSN---------- 449
            |.|||...:.|:|.|     .|.:|...|   |..:..|.......|.|:...:.          
Human     4 SSSPPRGPQQLSSFGSVDWLSQSSCSGPT---HTPRPADFSLGSLPGPGQTSGAREPPQAVSIKE 65

  Fly   450 -GGASNIGNTEDDQARLILK---RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGL 510
             .|:||:...|...|.|..:   .:..|.||:||.:|:.:||..|:...|.....|:|||.::.|
Human    66 AAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQL 130

  Fly   511 PEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTD--------SPNSLSAC 567
            .|.:|:.||.|||.|.:|:.: ..|..:|.|....|..:..|.::.|.:        :|.|....
Human   131 SEVQIKTWFQNRRMKHKRQMQ-DPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQA 194

  Fly   568 SSLLSGSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESPTP-IPHIRPSCTS 623
            ..|..||..|........|:|       ..|...|..: :|..||| .|.:.|:.::
Human   195 LMLPPGSFWGLCQVAQEALAS-------AGASCCGQPL-ASHPPTPGRPSLGPALST 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 20/91 (22%)
Homeobox 95..147 CDD:306543 22/51 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.