DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and LHX6

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens


Alignment Length:336 Identity:69/336 - (20%)
Similarity:111/336 - (33%) Gaps:122/336 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 QHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLS 375
            |..|.||....|....|.|.:|         |.:...:.:||.....:.      .|...|.:.|
Human    28 QVMAQPGSGCKATTRCLEGTAP---------PAMAQSDAEALAGALDKD------EGQASPCTPS 77

  Fly   376 EIPISSAPNIASVTAYASGPSLAHSLSPPNDIESL-----------------------ASIGHQR 417
            ...:.|.|:.||     |.||...::.....:|.|                       .|:..|.
Human    78 TPSVCSPPSAAS-----SVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQN 137

  Fly   418 NCPVATEDIHLKKEL----------DGHQ---SD----------------------ETGSGE--- 444
            :|.:..::|..|.:.          .|.|   ||                      :..:||   
Human   138 SCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFG 202

  Fly   445 ----------------------GENSNG----GASNIGNTEDDQARLILKRKLQRNRTSFTNDQI 483
                                  .||.||    ||  :.:.:|.|     .:..:|.|||||.:|:
Human   203 LVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGA--VPSEQDSQ-----PKPAKRARTSFTAEQL 260

  Fly   484 DSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATS 548
            ..::.:|.:.:.||....::||...||....|||||.|.||        |:::.||......:.:
Human   261 QVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRA--------RHKKHTPQHPVPPSGA 317

  Fly   549 SSTSATASLTD 559
            ..:...::|:|
Human   318 PPSRLPSALSD 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766 7/52 (13%)
LIM2_Lhx6 160..214 CDD:188768 6/53 (11%)
Homeobox 252..304 CDD:278475 22/59 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.