DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Alx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:320 Identity:90/320 - (28%)
Similarity:125/320 - (39%) Gaps:65/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 VTAYASGPSLAHSL-----SPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGEN 447
            |.|:...|...|.:     ||..|......|......|:.||   |.:.:||..:......:|..
  Rat    50 VQAFGPLPRAEHHVRLDRTSPCQDSSVNYGITKVEGQPLHTE---LNRAMDGCNNLRMSPVKGMP 111

  Fly   448 SNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPE 512
            .......:|:..|..   :...|.:|:||:||:.|::.|||.|::||||||:.||:||.:..|.|
  Rat   112 EKSELDELGDKCDSN---VSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTE 173

  Fly   513 ARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGG 577
            ||:||||.|||||||:.|:....::..:...|:...|....|.|.....|:|.|      |:..|
  Rat   174 ARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWA------GNTSG 232

  Fly   578 PSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCP 642
            .||.|...|..                 |:|...||..|   |..:|:..               
  Rat   233 GSVVTSCMLPR-----------------DASSCMTPYSH---SPRTDSSY--------------- 262

  Fly   643 LGVGGHQNTH-HIQSN---------GHAQGHALVPAISPRLNFNSGSFGAM-YSNMHHTA 691
            .|...|||.. |:..|         |...|||.  ...|.....|.|...: .....|||
  Rat   263 TGFSNHQNQFGHVPLNNFFTDSLLTGTTNGHAF--ETKPEFERRSSSIAVLRMKAKEHTA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 32/52 (62%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 36/172 (21%)
OAR 302..319 CDD:281777 2/16 (13%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.