DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Gm4981

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001030041.1 Gene:Gm4981 / 245263 MGIID:3645498 Length:291 Species:Mus musculus


Alignment Length:221 Identity:58/221 - (26%)
Similarity:88/221 - (39%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 LKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEK 531
            ::...:|..|..|..|...|.:.|||...|....||.||.:.||||..|..|..|:||:      
Mouse     1 MRSSSRRPHTGLTLSQRRILAQAFERNPRPGCATREELALETGLPEDMIHTWLKNKRAR------ 59

  Fly   532 LRNQRRTPNSTGASATSSSTS--ATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPS---- 590
             |::|..|.:......:|..|  |.|......:.::..|||....||...:.|.:...|||    
Mouse    60 -RHRRGRPTAQDQDLLASQVSGGAPAGPVGRGHEVAQESSLPQEEAGSTGMDTTSTSYSPSFCRE 123

  Fly   591 TLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLG--------VGG 647
            :..:.|:.|. |||  ..|.||...::.|.....::...:.:....|..|..||        .|.
Mouse   124 SQLSQVSQPR-GAG--QKEVPTQAGNVGPLELLLDELQDEVQVKEHVPDPLDLGSDPGAREPEGS 185

  Fly   648 HQNTHHIQSNGHAQGHALVPAISPRL 673
            ..:...:....::..|..||:||..|
Mouse   186 QDSLQSLDEAANSGWHTSVPSISSTL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Gm4981NP_001030041.1 homeodomain 6..56 CDD:238039 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.