DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Gsc2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_083745.2 Gene:Gsc2 / 195333 MGIID:892006 Length:201 Species:Mus musculus


Alignment Length:235 Identity:64/235 - (27%)
Similarity:95/235 - (40%) Gaps:66/235 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 EPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLS--EIPISSA 382
            :|.|..|.   |..|:             ..:|.:.:..:.||:...|. .|..|.  |.|:.:|
Mouse    12 DPGRPCPF---SIEHI-------------LSSLPERRPATRPPQPVGGR-NPAELDEPEAPVPAA 59

  Fly   383 P-------NIASVT----AYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQ 436
            |       |..:.|    ..:|||.|  .|:.|           .|..|.....:          
Mouse    60 PCACCCCCNPRAATRGTPETSSGPGL--RLAWP-----------LRLAPATPSPL---------- 101

  Fly   437 SDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFAR 501
               |....|..:..|.|..|.          :|:.:|:||.|:.:|:.:||..|.:..||||..|
Mouse   102 ---TAPRAGSPALTGTSGPGP----------QRRTRRHRTIFSEEQLQALEALFVQNQYPDVGTR 153

  Fly   502 ERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNS 541
            ||||.:|.|.|.|::|||.|||||||.:::..:.|..|.:
Mouse   154 ERLAVRIRLREERVEVWFKNRRAKWRHQKRASSSRLLPGT 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 28/51 (55%)
Gsc2NP_083745.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 11/57 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..123 6/49 (12%)
Homeobox 126..180 CDD:333795 29/53 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..201 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.