Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379631.1 | Gene: | ceh-16 / 191618 | WormBaseID: | WBGene00000439 | Length: | 187 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 49/201 - (24%) |
---|---|---|---|
Similarity: | 88/201 - (43%) | Gaps: | 63/201 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 371 PTSLSEIPISSAPNIASVTAYASG-PSLAHSLSPP-------NDIESLASIGHQRNCPVATEDIH 427
Fly 428 LKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFER 492
Fly 493 THYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASL 557
Fly 558 TDSPNS 563 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 24/51 (47%) | ||
ceh-16 | NP_001379631.1 | Homeobox | 90..144 | CDD:395001 | 24/53 (45%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |