DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and ceh-16

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001379631.1 Gene:ceh-16 / 191618 WormBaseID:WBGene00000439 Length:187 Species:Caenorhabditis elegans


Alignment Length:201 Identity:49/201 - (24%)
Similarity:88/201 - (43%) Gaps:63/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 PTSLSEIPISSAPNIASVTAYASG-PSLAHSLSPP-------NDIESLASIGHQRNCPVATEDIH 427
            |:.....|.:|..:|:...|..:| |::|.|:.|.       :|..| |...|:::         
 Worm    18 PSPTISTPATSPSSISPTFASPNGTPNIASSMYPAWVFSTRYSDRPS-AGPRHRKS--------- 72

  Fly   428 LKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFER 492
                   .:.:.|||.            |::|::          :|.||:||.||:|.|:.||..
 Worm    73 -------RKRESTGSS------------GSSEEE----------KRPRTAFTGDQLDRLKTEFRE 108

  Fly   493 THYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASL 557
            :.|.....|:.||.::||.|::|::||.|:|||.::                |.:|......:|:
 Worm   109 SRYLTEKRRQELAHELGLNESQIKIWFQNKRAKLKK----------------STSSVPRDRCSSV 157

  Fly   558 TDSPNS 563
            |.:|::
 Worm   158 TPNPHN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 24/51 (47%)
ceh-16NP_001379631.1 Homeobox 90..144 CDD:395001 24/53 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.