DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Pou4f3

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_620395.2 Gene:Pou4f3 / 18998 MGIID:102523 Length:338 Species:Mus musculus


Alignment Length:309 Identity:65/309 - (21%)
Similarity:96/309 - (31%) Gaps:99/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 GSEQEAIYEKLRLLNTQHAAGPG---PLEP------ARAAPLVGQSP----NHLGTRSSHPQLVH 346
            ||..|::..:...|........|   |.:|      ..:.|....||    :|....:|||.  |
Mouse    47 GSFDESLLARAEALAAVDIVSHGKNHPFKPDATYHTMSSVPCTSTSPTVPISHPAALTSHPH--H 109

  Fly   347 GNHQALQ----QHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAY---ASGPSLAHSLSP- 403
            ..||.|:    :|..   |....||...|.. |.:|....|:......:   |.|.|..|:::| 
Mouse   110 AVHQGLEGDLLEHIS---PTLSVSGLGAPEH-SVMPAQIHPHHLGAMGHLHQAMGMSHPHAVAPH 170

  Fly   404 -------------PNDIESLASIGHQRNCPVATED------------------------------ 425
                         |.::|:.|....||...:....                              
Mouse   171 SAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGAALANLKIPGVGSLSQSTICRFESLT 235

  Fly   426 ------IHLKKELDGHQSDETGSGEGENS-----NGGASNIGNTEDDQARLILKRKLQRNRTSFT 479
                  |.||..|.....:...:...:||     ||.                :||  |.|||..
Mouse   236 LSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGS----------------ERK--RKRTSIA 282

  Fly   480 NDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRR 528
            ..:..|||..|.....|.......:|.|:.|.:..::|||.|:|.|.:|
Mouse   283 APEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 17/51 (33%)
Pou4f3NP_620395.2 POU-IV box 56..65 1/8 (13%)
POU 179..256 CDD:197673 9/76 (12%)
Homeobox 277..331 CDD:395001 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.