DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and npax-2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_508396.3 Gene:npax-2 / 185967 WormBaseID:WBGene00018591 Length:233 Species:Caenorhabditis elegans


Alignment Length:123 Identity:52/123 - (42%)
Similarity:75/123 - (60%) Gaps:3/123 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 SGVNQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRA 163
            ||.||||..:..|.||....|::||:|...|.:.||||:.|.|::.||||||.||.:|||::|: 
 Worm    99 SGRNQLGRTYSPGLPLSMCEREEIVKLFQGGWKICDISKRLCVTHSCVSKILNRYRQTGSVKPK- 162

  Fly   164 IGGSKPRVATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLR 221
              .:|.....:.:|..:..|:.........|||::|:::.|||.||.||.||||.:||
 Worm   163 --DAKEGRTESPLVLAVRDYRSRLGMCRQSEIREQLIRDGVCTRDNAPSRSSINHILR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 50/121 (41%)
Homeobox 475..527 CDD:278475
npax-2NP_508396.3 PAX 97..218 CDD:128645 50/121 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0849
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.