DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Pax1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_006498974.1 Gene:Pax1 / 18503 MGIID:97485 Length:534 Species:Mus musculus


Alignment Length:398 Identity:148/398 - (37%)
Similarity:178/398 - (44%) Gaps:128/398 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RNLP-CLGTAGGS-GLGGIAGKPSPTMEAVEASTASHPHSTSSYFATTYYHLTDDECHSGVNQLG 105
            |.|| ||...||: .|...|| |||....  |...:.|.:.             ::.:..|||||
Mouse   137 RALPLCLSGGGGARALPDCAG-PSPRRSG--ARQLAGPRAM-------------EQTYGEVNQLG 185

  Fly   106 GVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPR 170
            ||||.|||||::.|.:|||||..|.|||||||.|:||:|||||||.||.|||||.|.||||||||
Mouse   186 GVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPR 250

  Fly   171 VATAEVVSKISQYKRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRN----LA------A 225
            |.|..||..|..||:..|.|||||||||||.:.||...|:||||||:|:|||    ||      |
Mouse   251 VTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGSLAQPGPYEA 315

  Fly   226 QKE-------------QQSTGSGSSST------------SAGNSISAKVSVSIGGNVSNV----- 260
            .|:             |....|..|.|            |||: :|...|.....:|||:     
Mouse   316 SKQPPPQPALPYNHIYQYPYPSPVSPTGTKMGTHPGVPGSAGH-VSIPRSWPSAHSVSNILGIRT 379

  Fly   261 -------ASGSRGTLSS----------------------------STDLMQTATPLNSSESGG-- 288
                   .:||.|...|                            ..|:..|.:..:.|..||  
Mouse   380 FMEQTGALAGSEGAAYSPKMEDWAGVNRAAFPTSPAVNGLEKPALEADIKYTQSASSLSAVGGFL 444

  Fly   289 ------ASNSGEGSEQEAIYEKLRLLNTQHAAG---PG-PLEPARAAPLVGQSPNHLGTRSSHPQ 343
                  |||      |..:|       :..|||   || |..||:|.||   :|:..|.      
Mouse   445 PACAYPASN------QHGVY-------SAPAAGYLSPGPPWPPAQAPPL---TPHGAGV------ 487

  Fly   344 LVHGNHQA 351
            .|||...|
Mouse   488 AVHGGELA 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 83/122 (68%)
Homeobox 475..527 CDD:278475
Pax1XP_006498974.1 PAX 177..304 CDD:238076 86/126 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.