DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Otp

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_035151.1 Gene:Otp / 18420 MGIID:99835 Length:325 Species:Mus musculus


Alignment Length:315 Identity:90/315 - (28%)
Similarity:127/315 - (40%) Gaps:79/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 PISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGS 442
            |...|||        |.|....:|.|..||.::.|.  ..:..|:.:|          ...:.|.
Mouse    42 PGDLAPN--------SDPVEGATLLPGEDITTVGST--PASLAVSAKD----------PDKQPGP 86

  Fly   443 GEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGK 507
            ..|.|    .|..|..:..|       |.:|:||.||..|::.||:.|.:|||||:|.||.||.:
Mouse    87 QGGPN----PSQAGQQQGQQ-------KQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALR 140

  Fly   508 IGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLS 572
            |||.|:|:||||.||||||::.:|..|..|.|         .:...|..|...|::.:|.::.: 
Mouse   141 IGLTESRVQVWFQNRRAKWKKRKKTTNVFRAP---------GTLLPTPGLPQFPSAAAAAAAAM- 195

  Fly   573 GSAGGPSVSTINGLSSPSTLSTNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRV 637
                           ..|..|.:.|.....|......|..|:|   |:.      |||....:.:
Mouse   196 ---------------GDSLCSFHANDTRWAAAAMPGVSQLPLP---PAL------GRQQAMAQSL 236

  Fly   638 CSPCPLGVGGHQNTHHIQ-----SNGHA-QGH-------ALVPAISPRLNFNSGS 679
             |.|.|..|...|:..:.     |||.. |.|       .:|||..|..:..|||
Mouse   237 -SQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGS 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
OtpNP_035151.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..112 23/100 (23%)
Homeobox 107..156 CDD:395001 28/48 (58%)
OAR 303..320 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.