DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and npax-4

DIOPT Version :10

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001255346.1 Gene:npax-4 / 182466 WormBaseID:WBGene00007496 Length:202 Species:Caenorhabditis elegans


Alignment Length:134 Identity:43/134 - (32%)
Similarity:61/134 - (45%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG 166
            |:.|..::.||||....||||||....|.:...|::.|.:::.||||:|.||.|||.|..:|.  
 Worm    80 NRYGRPYISGRPLLTCDRQKIVECYKKGMKKIHIAKQLGITHSCVSKVLRRYAETGEIVAKAC-- 142

  Fly   167 SKPRVATAEVVSKISQY-KRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQ 230
               |.|:........:: .|.|          :.||:|     .|....||..:|||       :
 Worm   143 ---RTASCSCPGSAEEHDARYC----------KHLQDN-----TIRLFFSIENLLRN-------E 182

  Fly   231 STGS 234
            ||.|
 Worm   183 STSS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 37/119 (31%)
Homeodomain 473..528 CDD:459649
npax-4NP_001255346.1 HTH_ARSR 79..>142 CDD:481197 26/61 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.