DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and npax-4

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001255346.1 Gene:npax-4 / 182466 WormBaseID:WBGene00007496 Length:202 Species:Caenorhabditis elegans


Alignment Length:134 Identity:43/134 - (32%)
Similarity:61/134 - (45%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NQLGGVFVGGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGG 166
            |:.|..::.||||....||||||....|.:...|::.|.:::.||||:|.||.|||.|..:|.  
 Worm    80 NRYGRPYISGRPLLTCDRQKIVECYKKGMKKIHIAKQLGITHSCVSKVLRRYAETGEIVAKAC-- 142

  Fly   167 SKPRVATAEVVSKISQY-KRECPSIFAWEIRDRLLQENVCTNDNIPSVSSINRVLRNLAAQKEQQ 230
               |.|:........:: .|.|          :.||:|     .|....||..:|||       :
 Worm   143 ---RTASCSCPGSAEEHDARYC----------KHLQDN-----TIRLFFSIENLLRN-------E 182

  Fly   231 STGS 234
            ||.|
 Worm   183 STSS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645 37/119 (31%)
Homeobox 475..527 CDD:278475
npax-4NP_001255346.1 HTH 79..>142 CDD:389747 26/61 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.