DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and ceh-51

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_507685.1 Gene:ceh-51 / 180233 WormBaseID:WBGene00013583 Length:234 Species:Caenorhabditis elegans


Alignment Length:290 Identity:63/290 - (21%)
Similarity:105/290 - (36%) Gaps:91/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 SAKVSVSIGGNVSNVASGSRGTLSSSTD--LMQTATPLNSSESGGASNSGEGSEQEAIYEKLRLL 308
            |:..:::.||:...::|.:..:.|:.|:  :|:.:| :.||..|..|:|                
 Worm     3 SSNYNINNGGDYYPLSSSNLNSTSAITNATVMEYST-MPSSSPGSMSSS---------------- 50

  Fly   309 NTQHAAGPGPLEPA---RAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWY 370
                     |..||   ..:|.....||.|..:.   ||.|..:..|.|...|::..:.:  :|:
 Worm    51 ---------PAYPAAYQAPSPCYVADPNQLYYQQ---QLAHNGNDMLVQAHAQAYQAQCF--AWF 101

  Fly   371 PTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGH 435
            ....|::..||.|:          |.:||               |....|.....:|       |
 Worm   102 QQQYSQLSPSSFPH----------PMVAH---------------HAGFIPPPPSFLH-------H 134

  Fly   436 QSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFA 500
            |..:......|...|.                       ||.|::.|:.:|...||:.....|..
 Worm   135 QHQQHPRAPSEKRRGA-----------------------RTPFSDSQLYALRTRFEQCDTIKVDE 176

  Fly   501 RERLAGKIGLPEARIQVWFSNRRAKWRREE 530
            |.:|...|||...:|::||.|||.|.|:|:
 Worm   177 RRKLGAVIGLSPEQIKIWFQNRRFKLRKEK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 20/51 (39%)
ceh-51NP_507685.1 Homeobox 151..204 CDD:365835 20/52 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.