DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Msx3

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_034966.1 Gene:Msx3 / 17703 MGIID:106587 Length:204 Species:Mus musculus


Alignment Length:140 Identity:39/140 - (27%)
Similarity:60/140 - (42%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 GHQRN--CPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQAR------------ 464
            ||..:  .|.:.|.:...:.:.|.:|.|.    |.....|||..|......|.            
Mouse    19 GHTEHGPLPFSVESLLEAERVPGSESGEL----GVERPLGASKPGAWPPPVAHSCPPRAPSPPPC 79

  Fly   465 LILKRKLQRN-RTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRR 528
            .:.|.|..|. ||.||..|:.:||::|.:..|..:..|...:..:.|.|.::::||.|||||.:|
Mouse    80 TLRKHKTNRKPRTPFTTAQLLALERKFHQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKR 144

  Fly   529 -----EEKLR 533
                 .|||:
Mouse   145 LQEAELEKLK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/51 (37%)
Msx3NP_034966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..89 11/53 (21%)
Homeobox 90..143 CDD:278475 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.