DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Hoxa5

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_034583.1 Gene:Hoxa5 / 15402 MGIID:96177 Length:270 Species:Mus musculus


Alignment Length:296 Identity:71/296 - (23%)
Similarity:107/296 - (36%) Gaps:89/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 GTLSSSTDLMQTATPLNSSESG----------GASNSGE-GSEQEAIYEKLRLLNTQHAAG--PG 317
            |..||.::..:.:..::|...|          |.|.||. ||.:.|         ..:|||  ..
Mouse    25 GDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSGSGHFGSGERA---------RSYAAGASAA 80

  Fly   318 PLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISS- 381
            |.||..:.|          ..|:|                 |.||            ..:|.|: 
Mouse    81 PAEPRYSQP----------ATSTH-----------------SPPP------------DPLPCSAV 106

  Fly   382 APNIASVTAYASGPSLAHSL-----SPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETG 441
            ||:..|.:.:....||.:|.     :....|.|...:|   ....|.||.....|..|.||:.:.
Mouse   107 APSPGSDSHHGGKNSLGNSSGASANAGSTHISSREGVG---TASAAEEDAPASSEQAGAQSEPSP 168

  Fly   442 SGEGE--------NSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDV 498
            :...:        ..:....|||..|.           :|.||::|..|...|||||....|...
Mouse   169 APPAQPQIYPWMRKLHISHDNIGGPEG-----------KRARTAYTRYQTLELEKEFHFNRYLTR 222

  Fly   499 FARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRN 534
            ..|..:|..:.|.|.:|::||.|||.||:::.||::
Mouse   223 RRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Hoxa5NP_034583.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 29/141 (21%)
Antp-type hexapeptide 176..181 0/4 (0%)
Homeobox 199..252 CDD:333795 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.