DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Hoxa11

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_034580.1 Gene:Hoxa11 / 15396 MGIID:96172 Length:313 Species:Mus musculus


Alignment Length:252 Identity:61/252 - (24%)
Similarity:105/252 - (41%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 SEQEAIYEKLRLLNTQHAAG-PGPLEPARAA-----PLVGQSPNHLGTRSSHPQLVHGNHQALQQ 354
            |.:|.::..  .|....||| ||.:....:|     |....|.|...|...:..|    .||..|
Mouse    85 SAEELVHRD--CLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVL----PQAFDQ 143

  Fly   355 HQQQSW-PPRHYSGSWYP--TSLSEIP-ISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGH 415
            ..:.:: .|.:.:.|.||  .:..:.| .::|.:.|:|.|.|:|.....|          :..|.
Mouse   144 FFETAYGTPENLASSDYPGDKNAEKGPQAAAATSAAAVAAAATGAPATSS----------SDGGG 198

  Fly   416 QRNC-PVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFT 479
            ...| ..|.|:...::..:...|.|:.||..|:..||:..              ::.::.|..:|
Mouse   199 GGGCQEAAAEEKERRRRPESSSSPESSSGHTEDKAGGSGG--------------QRTRKKRCPYT 249

  Fly   480 NDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQR 536
            ..||..||:||..:.|.:...|.:|:..:.|.:.::::||.|||.|   |:|:...|
Mouse   250 KYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMK---EKKINRDR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 18/51 (35%)
Hoxa11NP_034580.1 DUF3528 26..168 CDD:288866 21/88 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..246 12/81 (15%)
Homeobox 244..297 CDD:278475 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.