DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Hmx3

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_032283.3 Gene:Hmx3 / 15373 MGIID:107160 Length:356 Species:Mus musculus


Alignment Length:328 Identity:79/328 - (24%)
Similarity:121/328 - (36%) Gaps:84/328 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 QEAIYEKLRLLN-TQHAAGPGPLEPARA--APLVGQSPNHLGTRSSHPQLVHGNHQ-ALQQHQQQ 358
            :|:.:....||| ..|...|.|..|.|.  ||....:.......::....:.|... ||.|....
Mouse    27 KESPFSIRNLLNGDHHRPPPKPQPPPRTLFAPASAAAAAAAAAAAAAKGALEGAAGFALSQVGDL 91

  Fly   359 SWP-----------PRHY----SGSWYPTSLS----EIPISSAPNIASVTAYASGPSLAHSLSPP 404
            ::|           |.||    ...|||.:|:    .:|   .|.       ||..:|....||.
Mouse    92 AFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAGGHLP---RPE-------ASEKALLRDSSPA 146

  Fly   405 NDIESLASIGHQRNCP---VATEDIHLKKELDGHQSD---------ETGSGEGENSNGGA-SNIG 456
            :        |..|:.|   :..:..|  ||||....|         |.|..|||...|.| :.:|
Mouse   147 S--------GTDRDSPEPLLKADPDH--KELDSKSPDEIILEESDSEEGKKEGEAVPGAAGTTVG 201

  Fly   457 NT-------------EDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKI 508
            .|             |..:.:...::|  :.||.|:..|:..||..|:...|.....|..||..:
Mouse   202 ATTATPGSEDWKAGAESPEKKPACRKK--KTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASL 264

  Fly   509 GLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASA-----------TSSSTSATASLTDSPN 562
            .|.|.::::||.|||.||:|:  |..:....|.:.|:|           .:|:....|:...:|.
Mouse   265 HLTETQVKIWFQNRRNKWKRQ--LAAELEAANLSHAAAQRIVRVPILYHENSAAEGAAAAAGAPV 327

  Fly   563 SLS 565
            .:|
Mouse   328 PVS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/51 (37%)
Hmx3NP_032283.3 Homeobox 230..284 CDD:365835 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.