DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Hmx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_034575.1 Gene:Hmx1 / 15371 MGIID:107178 Length:332 Species:Mus musculus


Alignment Length:287 Identity:74/287 - (25%)
Similarity:99/287 - (34%) Gaps:83/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 ATPLNSS----------ESGGASNSGEGS-------------EQEAIYEKLRLL--NTQHAAGPG 317
            |||..:|          |:.||..|.:|.             |.|...:..|.|  ..|..||.|
Mouse    11 ATPARASSFLIENLLAAEAKGAGRSTQGDGVREEEEEDDDDPEDEDPEQARRRLQRRRQQRAGSG 75

  Fly   318 PLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSA 382
            |...|||..|      .||.|   |....|...||.......|.||.:.|  |...||       
Mouse    76 PGGEARARAL------GLGPR---PPPGPGPPFALGCGGTTRWYPRVHGG--YGGGLS------- 122

  Fly   383 PNIASVTAYASGPSL--AHSLSPPNDIESLASIGHQRNCP--------VATEDIHLKKELDGHQS 437
            |:.:...:..:|..:  |.|..|              .||        |.|            |.
Mouse   123 PDTSDRDSPETGEEMGRAESAWP--------------RCPGPGTVPREVTT------------QG 161

  Fly   438 DETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARE 502
            ..|| ||.......|..:......:||   ..:.::.||.|:..|:..||..|:...|.....|.
Mouse   162 PATG-GEEAAELAEAPAVAAAATGEAR---GGRRKKTRTVFSRSQVFQLESTFDLKRYLSSAERA 222

  Fly   503 RLAGKIGLPEARIQVWFSNRRAKWRRE 529
            .||..:.|.|.::::||.|||.||:|:
Mouse   223 GLAASLQLTETQVKIWFQNRRNKWKRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 19/51 (37%)
Hmx1NP_034575.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..170 46/186 (25%)
Homeobox 194..247 CDD:278475 19/52 (37%)
HMX family specific domain 1 251..261
HMX family specific domain 2 264..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.