Sequence 1: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032204.1 | Gene: | Gsx1 / 14842 | MGIID: | 95842 | Length: | 261 | Species: | Mus musculus |
Alignment Length: | 229 | Identity: | 57/229 - (24%) |
---|---|---|---|
Similarity: | 83/229 - (36%) | Gaps: | 59/229 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 395 PSLAHSLSPPNDIESLA-SIGHQRN------CP--VATEDIH----------LKKE--------- 431
Fly 432 ---LDGHQSDETGSGEGENSNGGASNIGNTE--------------DDQARLILKRKLQRNRTSFT 479
Fly 480 NDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGA 544
Fly 545 SA---------TSSSTSATASLTDSPNSLSACSS 569 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 20/51 (39%) | ||
Gsx1 | NP_032204.1 | SNAG domain. /evidence=ECO:0000250 | 1..20 | ||
Homeobox | 150..203 | CDD:395001 | 20/52 (38%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..261 | 16/53 (30%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |