DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and GSC

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_776248.1 Gene:GSC / 145258 HGNCID:4612 Length:257 Species:Homo sapiens


Alignment Length:202 Identity:60/202 - (29%)
Similarity:95/202 - (47%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 GSWYPTSLSEIPISSAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKE 431
            |::||.     |:  ||..|.:.|..||..|.::......:       |.:..||..........
Human    55 GAFYPR-----PV--APGGAGLPAAVSGSRLGYNNYFYGQL-------HVQAAPVGPACCGAVPP 105

  Fly   432 LDGHQSDETGSGEGENSNGGA------------SNIGNTEDDQARLILK---RKLQRNRTSFTND 481
            |...|.....:..|....|..            .|:|.....:.:|:.:   |:.:|:||.||::
Human   106 LGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDE 170

  Fly   482 QIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASA 546
            |:::||..|:.|.||||..||:||.|:.|.|.:::|||.|||||||| :|..:...:.|:...:.
Human   171 QLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRR-QKRSSSEESENAEKWNK 234

  Fly   547 TSSSTSA 553
            ||||.::
Human   235 TSSSKAS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 28/51 (55%)
GSCNP_776248.1 Homeobox 163..216 CDD:306543 28/52 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..257 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.