DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and CRX

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_000545.1 Gene:CRX / 1406 HGNCID:2383 Length:299 Species:Homo sapiens


Alignment Length:276 Identity:88/276 - (31%)
Similarity:128/276 - (46%) Gaps:55/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLR 533
            ||.:|.||:||..|::.||..|.:|.||||:|||.:|.||.|||:|:||||.|||||.|::.:.:
Human    37 RKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQ 101

  Fly   534 NQRRTPNSTGASA----TSSSTSATASLTDSPNSLSACSSL---LSGSAGGP--SVSTINGLSSP 589
            .|::.|....|.|    ..:.||...|....|:.|....|.   |.|.:|.|  :|:|:: :.||
Human   102 KQQQQPPGGQAKARPAKRKAGTSPRPSTDVCPDPLGISDSYSPPLPGPSGSPTTAVATVS-IWSP 165

  Fly   590 STLSTNVNAPTLGAGIDSSESPTPIPH---IRPS---CTSDNDNGRQS---EDCRRVCSPCPLGV 645
            ::.|....|...|. :.|..|.|..|:   ..|:   |:|.:..|..|   .......||....:
Human   166 ASESPLPEAQRAGL-VASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQL 229

  Fly   646 GGHQNTHHIQSNGHAQGHALVPAISPRLNFNSGSFGAMYSNMHHTALSMSDSYGAVTPIPS---- 706
            ||                   ||:||   .:..|.|...: ...|:|| ..||||.:|:.|    
Human   230 GG-------------------PALSP---LSGPSVGPSLA-QSPTSLS-GQSYGAYSPVDSLEFK 270

  Fly   707 -------FNHSAVGPL 715
                   |.::.:.||
Human   271 DPTGTWKFTYNPMDPL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
CRXNP_000545.1 Homeobox 43..93 CDD:395001 30/49 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..155 16/61 (26%)
TF_Otx 166..249 CDD:397546 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.