DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Dmbx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_017175446.1 Gene:Dmbx1 / 140477 MGIID:2153518 Length:389 Species:Mus musculus


Alignment Length:378 Identity:102/378 - (26%)
Similarity:143/378 - (37%) Gaps:134/378 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 RKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRR----- 528
            ||.:|:||:||..|:::|||.|::||||||..|||||....|||||:||||.|||||:|:     
Mouse    77 RKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSL 141

  Fly   529 -EEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPSTL 592
             :|:|:.|:....|.|.....:..|.|...|:.|..|         .:|.|.......||..|  
Mouse   142 QKEQLQKQKEAEGSHGEGKVEAPASDTQLETEQPPGL---------PSGDPPAELQLSLSEQS-- 195

  Fly   593 STNVNAPTLGAGIDSSESPTPIPHIRPSCTSDNDNGRQSEDCRRVCSPCPLGVGGHQNTHHIQSN 657
                          :|||       .|....|.:...::|:.:...||      |.::.      
Mouse   196 --------------ASES-------APEDQLDREEDSRAEEPKAEKSP------GSESK------ 227

  Fly   658 GHAQGHALVPAI---SPRLNFNSGSFGAMYSNMHHTALSMSDSYG--AVTPI--------PSFNH 709
                    ||..   ||:                      :||.|  |:||.        ||.::
Mouse   228 --------VPGCKRGSPK----------------------ADSPGSLAITPAAPGGGLLGPSHSY 262

  Fly   710 SAVGPLAPPSPIPQQGDLTPSSLYPCHMTLRPPPMAP---AHHHIVPGDGGRPAGVGLGSGQSAN 771
            |:                :|.||:......|....|.   .|:......|..||.....:.....
Mouse   263 SS----------------SPLSLFRLQEQFRQHMAATNNLMHYSSFEVGGPAPAAAAAAAAAVPY 311

  Fly   772 LGAS--------CSGSGYEVLSAYA-----------LPPPP--MASSSAADSS 803
            ||.:        |. |.|:.|||.|           ||.||  :|.:|||.:|
Mouse   312 LGVNMAPLSSLHCQ-SYYQSLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 34/51 (67%)
Dmbx1XP_017175446.1 Homeobox 82..136 CDD:365835 34/53 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.