DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Emx1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_034261.1 Gene:Emx1 / 13796 MGIID:95387 Length:257 Species:Mus musculus


Alignment Length:270 Identity:76/270 - (28%)
Similarity:106/270 - (39%) Gaps:98/270 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 SGGASNS-GEGSEQEAI---YEKLR--LLNTQHAAGPGPLE-------PARAAPLVGQSPNHLGT 337
            :||:..| |.||...|:   .|.||  .||..|   |...|       ||.||...|:|      
Mouse    22 TGGSPGSGGAGSHPLAVAASEEPLRPTALNYPH---PSAAETAFVSGFPAAAAAGAGRS------ 77

  Fly   338 RSSHPQLVHG---NHQALQQHQQQSWPPRHYSGSWYPTSLSEIPISSAPNIASVTAYASGPSLAH 399
            ....|:||..   ||.||..|      |.|..||                              .
Mouse    78 LYGGPELVFPEAMNHPALTVH------PAHQLGS------------------------------S 106

  Fly   400 SLSPPNDIESLASIGHQRNCPVATEDIH-----LKKELDGHQSDETGSGEGENSNGGASNIGNTE 459
            ||.||:   |..|..|:       :.:|     |:....||:..             ||::    
Mouse   107 SLQPPH---SFFSAQHR-------DPLHFYPWVLRNRFFGHRFQ-------------ASDV---- 144

  Fly   460 DDQARLIL----KRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFS 520
             .|..|:|    .||.:|.||:|:..|:..||:.||:.||.....|::|||.:.|.|.:::|||.
Mouse   145 -PQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQ 208

  Fly   521 NRRAKWRREE 530
            |||.|::|::
Mouse   209 NRRTKYKRQK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 23/51 (45%)
Emx1NP_034261.1 COG5576 108..>218 CDD:227863 42/137 (31%)
Homeobox 163..215 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.