DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and AgaP_AGAP004659

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_311616.1 Gene:AgaP_AGAP004659 / 1272726 VectorBaseID:AGAP004659 Length:372 Species:Anopheles gambiae


Alignment Length:366 Identity:86/366 - (23%)
Similarity:134/366 - (36%) Gaps:114/366 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 VSNVAS----GSRGTLSSSTDLMQTATPLNSSESGGASNSG---EGSEQEAIYEKLRLLNTQHAA 314
            |:::||    .|:.|.||.          |::.|.|:.|.|   ..:....||.     .|.|.|
Mosquito    14 VNSIASCYPNNSQNTNSSP----------NTAGSQGSQNDGYFPPSTYAPNIYP-----GTPHQA 63

  Fly   315 GPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQAL----------------QQHQQQSWPPR 363
               ...|....||.|.....:.:.|:  ..|.|.||:.                ||.|.||....
Mosquito    64 ---HYSPQSYNPLAGAGATSVNSAST--GAVGGGHQSTDMVDYTQLQPQKFLLSQQQQPQSALTS 123

  Fly   364 H---YSGSWYPTSLSEI------PISSAPNIASVTAYASG--------PSLAHSLSPPNDIESLA 411
            .   |:.....|..:.|      ..:|..::::.:..:||        |.::..|||.:.:||::
Mosquito   124 QSCKYASEGPSTGTNVINNNNNNSTTSPQDLSTASGGSSGANDGNNGRPEISPKLSPGSVVESVS 188

  Fly   412 ------------------------SIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGA 452
                                    |..:|.|.|:|:      .|.:...||:....||.:|.||.
Mosquito   189 RSLKSGNPSTAVSSSSTNNNTSNISNRNQVNLPLAS------PEEESEASDDDSGTEGGSSQGGG 247

  Fly   453 S-------------------NIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDV 498
            .                   :||     |:.:....:.:|.|||:|..|...|||||....|...
Mosquito   248 GSSSKKGGPPPHIYPWMKRVHIG-----QSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTR 307

  Fly   499 FARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTP 539
            ..|..:|..:.|.|.:|::||.|||.||::|.|:.:....|
Mosquito   308 RRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNIVP 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 22/51 (43%)
AgaP_AGAP004659XP_311616.1 Homeobox 284..336 CDD:278475 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.