DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Cdx4

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_031700.1 Gene:Cdx4 / 12592 MGIID:88362 Length:282 Species:Mus musculus


Alignment Length:328 Identity:81/328 - (24%)
Similarity:120/328 - (36%) Gaps:94/328 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 GTLSSSTDLMQTATPLNSSESGGASNSGEGSEQEAIYEKLRLLNTQHAAGPGPLEPARAAPLVGQ 330
            |||.|         |..||.:|..::.|.||                   |.|.....|||:.  
Mouse    16 GTLRS---------PGGSSTAGVGTSGGSGS-------------------PLPASNFTAAPVY-- 50

  Fly   331 SPNHLGTRSSHPQL----VHGNHQALQQHQQQSWPPRH----YSGSWYPTSLSEIPIS------- 380
             |:::|    :|.:    .||  .:|........|||.    |.|.  |:::..:|::       
Mouse    51 -PHYVG----YPHMSNMDPHG--PSLGAWSSPYSPPREDWSTYPGP--PSTMGTVPMNDMTSPVF 106

  Fly   381 SAPNIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEG 445
            .:|:. |.....||.|...|| |....|||.|                   ||...|..|.....
Mouse   107 GSPDY-STLGPTSGASNGGSL-PDAASESLVS-------------------LDSGTSGATSPSRS 150

  Fly   446 ENS-----NGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLA 505
            .:|     .......|.|          |..::.|..:|:.|...|||||....|..:..:..||
Mouse   151 RHSPYAWMRKTVQVTGKT----------RTKEKYRVVYTDHQRLELEKEFHCNRYITIRRKSELA 205

  Fly   506 GKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSL 570
            ..:||.|.::::||.|||||.|:  .::.:.....:||.|..|.|.|.:..  :.||:.....|.
Mouse   206 VNLGLSERQVKIWFQNRRAKERK--MIKKKISQFENTGGSVQSDSGSISPG--ELPNAFFTTPSA 266

  Fly   571 LSG 573
            :.|
Mouse   267 VRG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Cdx4NP_031700.1 Caudal_act 13..160 CDD:309740 46/203 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..36 9/28 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..156 17/78 (22%)
Homeobox 175..227 CDD:306543 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.