DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Barhl1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_476450.1 Gene:Barhl1 / 117232 RGDID:620648 Length:327 Species:Rattus norvegicus


Alignment Length:353 Identity:87/353 - (24%)
Similarity:124/353 - (35%) Gaps:102/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 HAAGPGPLEPARAAPLVG--QSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSL 374
            |.|| .|..| :..||:|  :||..|..||.                                |.
  Rat    15 HRAG-SPALP-KGDPLLGDCRSPLELSPRSE--------------------------------SS 45

  Fly   375 SEIPISSAP------NIASVTAYASGPSLAHSLSPPN---------------------DIESLA- 411
            |:....::|      ...|....||||.|...|.|..                     |.:.|| 
  Rat    46 SDCSSPASPGRDCLETSTSRPGAASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAA 110

  Fly   412 -----SIGHQ-------RNCPVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDD-QA 463
                 |.|..       |....|.||  .:.:||...|..:...|.:....|...|.::.|. ..
  Rat   111 CAPYSSSGQPAAPEPGGRLAAKAGED--FRDKLDKSVSSASSDSEYKVKEEGDREISSSRDSPPV 173

  Fly   464 RLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRR 528
            ||   :|.::.||:||:.|:..||:.|||..|..|..|..||..:.|.:.:::.|:.|||.||:|
  Rat   174 RL---KKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKR 235

  Fly   529 EEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGPSVSTINGLSSPSTLS 593
            :        |.......|.:.:.||...:..||....  .||:|....|.::....|.|:|....
  Rat   236 Q--------TAVGLELLAEAGNYSALQRMFPSPYFYP--QSLVSNLDPGAALYLYRGPSAPPPAL 290

  Fly   594 TNVNAPTL------GAGIDSSESPTPIP 615
            .....|.:      ||    ||.|.|:|
  Rat   291 QRPLVPRILIHGLQGA----SEPPPPLP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Barhl1NP_476450.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 24/108 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..181 16/72 (22%)
Homeobox 182..235 CDD:395001 22/52 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..327 7/16 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.