DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Prrx2

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_001099209.1 Gene:Prrx2 / 113931 RGDID:1311471 Length:248 Species:Rattus norvegicus


Alignment Length:215 Identity:74/215 - (34%)
Similarity:104/215 - (48%) Gaps:39/215 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 SLAHSLSPPNDIESLASIGHQRNCPVATEDIH---LKKELDGHQSDETGSGEGE---NSNGGASN 454
            |::|.|    |:|.:|:.|.:...||...:..   .::...|....|....:||   ..:|.|:.
  Rat    34 SVSHLL----DLEEVAAAGRRAAGPVPGPEAREGAAREPSGGSSGSEAAPQDGECAAPGHGSATK 94

  Fly   455 IGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWF 519
                        .|:|.:||||:|.:.|:.:||:.||||||||.|.||.||.::.|.|||:||||
  Rat    95 ------------RKKKQRRNRTTFNSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQVWF 147

  Fly   520 SNRRAKWRREEKLRNQRRTPN---STGASATSSSTSATASLTDSPNSL-----SACSSLLSGSAG 576
            .|||||:||.|:.....|:.:   |.|..|......|....|.||:.|     |..||:...|.|
  Rat   148 QNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTLSPDYLSWPASSPYSSVPPYSPG 212

  Fly   577 GPSVSTINGLSSPSTLSTNV 596
            |         |||:|...|:
  Rat   213 G---------SSPATPGVNM 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 32/51 (63%)
Prrx2NP_001099209.1 Homeobox 104..156 CDD:395001 31/51 (61%)
COG5576 <110..214 CDD:227863 47/112 (42%)
OAR 222..238 CDD:397759 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.