DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Lmx1a

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:NP_387501.1 Gene:Lmx1a / 110648 MGIID:1888519 Length:382 Species:Mus musculus


Alignment Length:268 Identity:59/268 - (22%)
Similarity:98/268 - (36%) Gaps:89/268 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 NIASVTAYASGPSLAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETGSGEGENS 448
            ::.|..|..||.|        :|.|||....|                         |:|:|.:.
Mouse   156 SLVSPAASDSGKS--------DDEESLCKSAH-------------------------GAGKGASE 187

  Fly   449 NGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFARERLAGKIGLPEA 513
            :|        :|       .::.:|.||..|..|..:.:..||.:..|....||.||.:.||...
Mouse   188 DG--------KD-------HKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVR 237

  Fly   514 RIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATSSSTSATASLTDSPNSLSACSSLLSGSAGGP 578
            .:||||.|:|||.::..:.:.|::.........||:.|:.                  ||:||  
Mouse   238 VVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLTSAQTNG------------------SGNAG-- 282

  Fly   579 SVSTINGLSSP-STLSTNVNAPTLGAGIDSSE------SPTPIP--HIRP--------SCTSDND 626
                :.|:.:| :||.|......:...:.:|:      :|..:|  |:.|        ...||:.
Mouse   283 ----MEGIMNPYTTLPTPQQLLAIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDT 343

  Fly   627 NGRQSEDC 634
            :.....||
Mouse   344 SLSNLGDC 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Lmx1aNP_387501.1 LIM1_Lmx1a 35..86 CDD:188756
LIM2_Lmx1a_Lmx1b 94..148 CDD:188764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..208 19/94 (20%)
Homeobox 198..252 CDD:365835 21/53 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..286 8/57 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.