DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ey and Prrxl1

DIOPT Version :9

Sequence 1:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Prrxl1 / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:341 Identity:100/341 - (29%)
Similarity:134/341 - (39%) Gaps:114/341 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 PVATEDIHLKKELDGHQSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQID 484
            |.|....|...:|:|            .:..|..:.|:.:|.    .|:||.:||||:||..|::
Mouse    89 PSAMFYFHCPPQLEG------------TAPFGNHSTGDFDDG----FLRRKQRRNRTTFTLQQLE 137

  Fly   485 SLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGAS-ATS 548
            :||..|.:|||||||.||.||.||.|.|||:||||.|||||||:.|:           ||| ...
Mouse   138 ALEAVFAQTHYPDVFTREELAMKINLTEARVQVWFQNRRAKWRKTER-----------GASDQEP 191

  Fly   549 SSTSATASLTDSP-----------------NSLSACSSLLSGSAGGPSVSTINGLSSPSTL-STN 595
            .:....|.:|..|                 .:|.|..||  |...||:     |...||.| .|.
Mouse   192 GAKEPMAEVTPPPVRNINSPPPGDQTRSKKEALEAQQSL--GRTVGPT-----GPFFPSCLPGTL 249

  Fly   596 VNAPTLGAGIDSSESPTPIPHIR-----PSCTSDNDNGRQSEDCRRVCSPCPLGVGGHQNTHHIQ 655
            :|..|....:.         |:.     |.|:           |   |.|.|:|: ....|:..|
Mouse   250 LNTATYAQALS---------HVASLKGGPLCS-----------C---CVPDPMGL-SFLPTYGCQ 290

  Fly   656 SNGHAQGHALVPAISPRLNFNSGSFGAMYSNMHHTALSMSDSYGAVTPIPSFNHSAVGPL---AP 717
            ||..|...||                .|.:..|..|:..|.:.     :|| ..|:.||.   ||
Mouse   291 SNRTASVAAL----------------RMKAREHSEAVLQSANL-----LPS-TSSSPGPASKQAP 333

  Fly   718 P-------SPIPQQGD 726
            |       ||..:|.:
Mouse   334 PEGSQDKTSPTKEQSE 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 34/51 (67%)
Prrxl1XP_006518472.1 Homeobox 128..181 CDD:365835 35/52 (67%)
OAR 292..309 CDD:367680 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.